Apc10 (ANAPC10) (NM_014885) Human Mass Spec Standard

CAT#: PH302679

ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700)

Product Images

Coomassie blue staining of purified ANAPC10 protein (Cat# TP302679). The protein was produced from HEK293T cells transfected with ANAPC10 cDNA clone (Cat# RC202679) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202679
• Predicted MW: 21.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202679 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR
  KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA
  VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055700
• RefSeq Size: 1457
• RefSeq ORF: 555
• Synonyms: APC10; DOC1
• Locus ID: 10393
• UniProt ID: Q9UM13
• Cytogenetics: 4q31.21
• Summary: ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]). [supplied by OMIM, Feb 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis