Apc10 (ANAPC10) (NM_014885) Human Recombinant Protein
CAT#: TP302679
Recombinant protein of human anaphase promoting complex subunit 10 (ANAPC10)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202679 protein sequence
Red=Cloning site Green=Tags(s) MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.1 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055700 |
| Locus ID | 10393 |
| UniProt ID | Q9UM13 |
| Cytogenetics | 4q31.21 |
| Refseq Size | 1457 |
| Refseq ORF | 555 |
| Synonyms | APC10; DOC1 |
| Summary | ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414956 | ANAPC10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY414956 | Transient overexpression lysate of anaphase promoting complex subunit 10 (ANAPC10) |
USD 436.00 |
|
| PH302679 | ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China