PREI3 (MOB4) (NM_199482) Human Mass Spec Standard
CAT#: PH302689
MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_955776)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202689 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC202689 representing NM_199482
Red=Cloning site Green=Tags(s) MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI LEEEVQNSVSGESEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_955776 |
RefSeq Size | 2698 |
RefSeq ORF | 675 |
Synonyms | 2C4D; CGI-95; MOB1; MOB3; MOBKL3; PHOCN; PREI3 |
Locus ID | 25843 |
UniProt ID | Q9Y3A3 |
Cytogenetics | 2q33.1 |
Summary | This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1. [provided by RefSeq, Feb 2011] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402432 | MOB4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404580 | MOB4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402432 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1 |
USD 396.00 |
|
LY404580 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2 |
USD 396.00 |
|
PH313507 | MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_056202) |
USD 2,055.00 |
|
TP302689 | Purified recombinant protein of Homo sapiens MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2 |
USD 823.00 |
|
TP313507 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1 |
USD 748.00 |
|
TP720256 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 3 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review