PREI3 (MOB4) (NM_015387) Human Mass Spec Standard

CAT#: PH313507

MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_056202)

Product Images

Coomassie blue staining of purified MOB4 protein (Cat# TP313507). The protein was produced from HEK293T cells transfected with MOB4 cDNA clone (Cat# RC213507) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213507
• Predicted MW: 25.9 kDa
• Protein Sequence:
  Sequence Link

  >RC213507 representing NM_015387
  Red=Cloning site Green=Tags(s)
  
  MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK
  YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK
  YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI
  LEEEVQNSVSGESEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056202
• RefSeq Size: 2709
• RefSeq ORF: 675
• Synonyms: 2C4D; CGI-95; MOB1; MOB3; MOBKL3; PHOCN; PREI3
• Locus ID: 25843
• UniProt ID: Q9Y3A3, A0A024R3X9
• Cytogenetics: 2q33.1
• Summary: This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1. [provided by RefSeq, Feb 2011]