CRSP9 (MED7) (NM_004270) Human Mass Spec Standard
CAT#: PH302696
MED7 MS Standard C13 and N15-labeled recombinant protein (NP_004261)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202696 |
Predicted MW | 27.1 kDa |
Protein Sequence |
>RC202696 representing NM_004270
Red=Cloning site Green=Tags(s) MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH RRDQIIEKDAALCVLIDEMNERP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004261 |
RefSeq Size | 1066 |
RefSeq ORF | 699 |
Synonyms | ARC34; CRSP9; CRSP33 |
Locus ID | 9443 |
UniProt ID | O43513, Q6IAZ5 |
Cytogenetics | 5q33.3 |
Summary | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418057 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420292 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426128 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418057 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 2 |
USD 396.00 |
|
LY420292 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 1 |
USD 396.00 |
|
LY426128 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 1 |
USD 396.00 |
|
TP302696 | Recombinant protein of human mediator complex subunit 7 (MED7), transcript variant 2 |
USD 823.00 |
|
TP761746 | Purified recombinant protein of Human mediator complex subunit 7 (MED7), transcript variant 1, full length, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review