ARL 1 (ARL1) (NM_001177) Human Mass Spec Standard

CAT#: PH302698

ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168)

Product Images

Coomassie blue staining of purified ARL1 protein (Cat# TP302698). The protein was produced from HEK293T cells transfected with ARL1 cDNA clone (Cat# RC202698) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202698
• Predicted MW: 20.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202698 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGG
  QTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMA
  NSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001168
• RefSeq Size: 3253
• RefSeq ORF: 543
• Synonyms: ARFL1
• Locus ID: 400
• UniProt ID: P40616
• Cytogenetics: 12q23.2
• Summary: The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]