ARL 1 (ARL1) (NM_001177) Human Recombinant Protein

CAT#: TP302698

Recombinant protein of human ADP-ribosylation factor-like 1 (ARL1)

Product Images

Coomassie blue staining of purified ARL1 protein (Cat# TP302698). The protein was produced from HEK293T cells transfected with ARL1 cDNA clone (Cat# RC202698) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202698 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGG
  QTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMA
  NSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001168
• Locus ID: 400
• UniProt ID: P40616
• Cytogenetics: 12q23.2
• Refseq Size: 3253
• Refseq ORF: 543
• Synonyms: ARFL1
• Summary: The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]