CLIC3 (NM_004669) Human Mass Spec Standard

CAT#: PH302726

CLIC3 MS Standard C13 and N15-labeled recombinant protein (NP_004660)

Product Images

Coomassie blue staining of purified CLIC3 protein (Cat# TP302726). The protein was produced from HEK293T cells transfected with CLIC3 cDNA clone (Cat# RC202726) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202726
• Predicted MW: 26.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202726 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD
  AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDS
  YLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM
  QEKEFKYTCPHSAEILAAYRPAVHPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004660
• RefSeq Size: 813
• RefSeq ORF: 708
• Synonyms: chloride intracellular channel 3; OTTHUMP00000022630
• Locus ID: 9022
• UniProt ID: O95833
• Cytogenetics: 9q34.3
• Summary: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other