Germany
Japan
United Kingdom
China
CLIC3 (NM_004669) Human Recombinant Protein
CAT#: TP302726
Recombinant protein of human chloride intracellular channel 3 (CLIC3)
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202726 protein sequence
Red=Cloning site Green=Tags(s) MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDS YLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM QEKEFKYTCPHSAEILAAYRPAVHPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004660 |
| Locus ID | 9022 |
| UniProt ID | O95833 |
| Cytogenetics | 9q34.3 |
| Refseq Size | 813 |
| Refseq ORF | 708 |
| Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417836 | CLIC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417836 | Transient overexpression lysate of chloride intracellular channel 3 (CLIC3) |
USD 396.00 |
|
| PH302726 | CLIC3 MS Standard C13 and N15-labeled recombinant protein (NP_004660) |
USD 2,055.00 |
|
| TP720996 | Purified recombinant protein of Human chloride intracellular channel 3 (CLIC3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
