TXNL2 (GLRX3) (NM_006541) Human Mass Spec Standard

CAT#: PH302731

GLRX3 MS Standard C13 and N15-labeled recombinant protein (NP_006532)

Product Images

Coomassie blue staining of purified GLRX3 protein (Cat# TP302731). The protein was produced from HEK293T cells transfected with GLRX3 cDNA clone (Cat# RC202731) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202731
• Predicted MW: 37.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202731 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEA
  EGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL
  THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELI
  GGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYET
  FDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006532
• RefSeq Size: 1343
• RefSeq ORF: 1005
• Synonyms: GLRX4; GRX3; GRX4; PICOT; TXNL2; TXNL3
• Locus ID: 10539
• UniProt ID: O76003, A0A140VJK1
• Cytogenetics: 10q26.3
• Summary: This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]
• Protein Families: Druggable Genome