NFYB (NM_006166) Human Mass Spec Standard

CAT#: PH302749

NFYB MS Standard C13 and N15-labeled recombinant protein (NP_006157)

Product Images

Coomassie blue staining of purified NFYB protein (Cat# TP302749). The protein was produced from HEK293T cells transfected with NFYB cDNA clone (Cat# RC202749) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202749
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202749 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN
  AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK
  FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006157
• RefSeq Size: 3482
• RefSeq ORF: 621
• Synonyms: CBF-A; CBF-B; HAP3; NF-YB
• Locus ID: 4801
• UniProt ID: P25208, A0A024RBG7
• Cytogenetics: 12q23.3
• Summary: The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors
• Protein Pathways: Antigen processing and presentation