NFYB (NM_006166) Human Recombinant Protein

CAT#: TP302749

Recombinant protein of human nuclear transcription factor Y, beta (NFYB)

Product Images

Coomassie blue staining of purified NFYB protein (Cat# TP302749). The protein was produced from HEK293T cells transfected with NFYB cDNA clone (Cat# RC202749) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202749 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN
  AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK
  FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006157
• Locus ID: 4801
• UniProt ID: P25208, A0A024RBG7
• Cytogenetics: 12q23.3
• Refseq Size: 3482
• Refseq ORF: 621
• Synonyms: CBF-A; CBF-B; HAP3; NF-YB
• Summary: The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors
• Protein Pathways: Antigen processing and presentation