myosin light chain 1 (MYL1) (NM_079422) Human Mass Spec Standard

CAT#: PH302750

MYL1 MS Standard C13 and N15-labeled recombinant protein (NP_524146)

Product Images

Coomassie blue staining of purified MYL1 protein (Cat# TP302750). The protein was produced from HEK293T cells transfected with MYL1 cDNA clone (Cat# RC202750) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202750
• Predicted MW: 16.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202750 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL
  PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY
  EAFVKHIMSI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_524146
• RefSeq Size: 862
• RefSeq ORF: 450
• Synonyms: MLC1F; MLC3F; MYOFTA
• Locus ID: 4632
• UniProt ID: P05976
• Cytogenetics: 2q34
• Summary: 'Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]'