myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein

CAT#: TP302750

Recombinant protein of human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f

Product Images

Coomassie blue staining of purified MYL1 protein (Cat# TP302750). The protein was produced from HEK293T cells transfected with MYL1 cDNA clone (Cat# RC202750) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202750 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL
  PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY
  EAFVKHIMSI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_524146
• Locus ID: 4632
• UniProt ID: P05976
• Cytogenetics: 2q34
• Refseq Size: 862
• Refseq ORF: 450
• Synonyms: MLC1F; MLC3F; MYOFTA
• Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]