myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein
CAT#: TP302750
Recombinant protein of human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202750 protein sequence
Red=Cloning site Green=Tags(s) MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY EAFVKHIMSI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_524146 |
Locus ID | 4632 |
UniProt ID | P05976 |
Cytogenetics | 2q34 |
Refseq Size | 862 |
Refseq ORF | 450 |
Synonyms | MLC1F; MLC3F; MYOFTA |
Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409202 | MYL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409202 | Transient overexpression lysate of myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f |
USD 396.00 |
|
PH302750 | MYL1 MS Standard C13 and N15-labeled recombinant protein (NP_524146) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review