CD69 (NM_001781) Human Mass Spec Standard

CAT#: PH302756

CD69 MS Standard C13 and N15-labeled recombinant protein (NP_001772)

Product Images

Coomassie blue staining of purified CD69 protein (Cat# TP302756). The protein was produced from HEK293T cells transfected with CD69 cDNA clone (Cat# RC202756) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202756
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202756 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG
  QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE
  HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001772
• RefSeq Size: 1676
• RefSeq ORF: 597
• Synonyms: AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3
• Locus ID: 969
• UniProt ID: Q07108, Q53ZX0
• Cytogenetics: 12p13.31
• Summary: 'This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane