CD69 (NM_001781) Human Recombinant Protein
CAT#: TP302756
Recombinant protein of human CD69 molecule (CD69), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202756 protein sequence
Red=Cloning site Green=Tags(s) MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001772 |
Locus ID | 969 |
UniProt ID | Q07108, Q53ZX0 |
Cytogenetics | 12p13.31 |
Refseq Size | 1676 |
Refseq ORF | 597 |
Synonyms | AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3 |
Summary | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400672 | CD69 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400672 | Transient overexpression lysate of CD69 molecule (CD69), transcript variant 1 |
USD 325.00 |
|
PH302756 | CD69 MS Standard C13 and N15-labeled recombinant protein (NP_001772) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review