CD69 (NM_001781) Human Recombinant Protein

CAT#: TP302756

Recombinant protein of human CD69 molecule (CD69), transcript variant 1

Product Images

Coomassie blue staining of purified CD69 protein (Cat# TP302756). The protein was produced from HEK293T cells transfected with CD69 cDNA clone (Cat# RC202756) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202756 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG
  QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE
  HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001772
• Locus ID: 969
• UniProt ID: Q07108, Q53ZX0
• Cytogenetics: 12p13.31
• Refseq Size: 1676
• Refseq ORF: 597
• Synonyms: AIM; BL-AC/P26; CLEC2C; EA1; GP32/28; MLR-3
• Summary: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane