Surb7 (MED21) (NM_004264) Human Mass Spec Standard

CAT#: PH302763

MED21 MS Standard C13 and N15-labeled recombinant protein (NP_004255)

Product Images

Coomassie blue staining of purified MED21 protein (Cat# TP302763). The protein was produced from HEK293T cells transfected with MED21 cDNA clone (Cat# RC202763) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202763
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202763 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID
  VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS
  LPDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004255
• RefSeq Size: 2705
• RefSeq ORF: 432
• Synonyms: hSrb7; SRB7; SURB7
• Locus ID: 9412
• UniProt ID: Q13503, A0A024RAW0
• Cytogenetics: 12p11.23
• Summary: This gene encodes a member of the mediator complex subunit 21 family. The encoded protein interacts with the human RNA polymerase II holoenzyme and is involved in transcriptional regulation of RNA polymerase II transcribed genes. A pseudogene of this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
• Protein Families: Transcription Factors