Surb7 (MED21) (NM_004264) Human Recombinant Protein

CAT#: TP302763

Recombinant protein of human mediator complex subunit 21 (MED21)

Product Images

Coomassie blue staining of purified MED21 protein (Cat# TP302763). The protein was produced from HEK293T cells transfected with MED21 cDNA clone (Cat# RC202763) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202763 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID
  VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS
  LPDS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004255
• Locus ID: 9412
• UniProt ID: Q13503, A0A024RAW0
• Cytogenetics: 12p11.23
• Refseq Size: 2705
• Refseq ORF: 432
• Synonyms: hSrb7; SRB7; SURB7
• Summary: This gene encodes a member of the mediator complex subunit 21 family. The encoded protein interacts with the human RNA polymerase II holoenzyme and is involved in transcriptional regulation of RNA polymerase II transcribed genes. A pseudogene of this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
• Protein Families: Transcription Factors