Apolipoprotein CII (APOC2) (NM_000483) Human Mass Spec Standard

CAT#: PH302771

APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474)

Product Images

Coomassie blue staining of purified APOC2 protein (Cat# TP302771). The protein was produced from HEK293T cells transfected with APOC2 cDNA clone (Cat# RC202771) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202771
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202771 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK
  LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000474
• RefSeq Size: 738
• RefSeq ORF: 303
• Synonyms: APO-CII; APOC-II
• Locus ID: 344
• UniProt ID: P02655, A0A024R0T9
• Cytogenetics: 19q13.32
• Summary: 'This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011]'
• Protein Families: Druggable Genome, Secreted Protein