Apolipoprotein CII (APOC2) (NM_000483) Human Recombinant Protein
CAT#: TP302771
Recombinant protein of human apolipoprotein C-II (APOC2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202771 protein sequence
Red=Cloning site Green=Tags(s) MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000474 |
Locus ID | 344 |
UniProt ID | P02655, A0A024R0T9 |
Cytogenetics | 19q13.32 |
Refseq Size | 738 |
Refseq ORF | 303 |
Synonyms | APO-CII; APOC-II |
Summary | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424693 | APOC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424693 | Transient overexpression lysate of apolipoprotein C-II (APOC2) |
USD 396.00 |
|
PH302771 | APOC2 MS Standard C13 and N15-labeled recombinant protein (NP_000474) |
USD 2,055.00 |
|
TP721060 | Purified recombinant protein of Human apolipoprotein C-II (APOC2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review