Secretogranin V (SCG5) (NM_003020) Human Mass Spec Standard

CAT#: PH302772

SCG5 MS Standard C13 and N15-labeled recombinant protein (NP_003011)

Product Images

Coomassie blue staining of purified SCG5 protein (Cat# TP302772). The protein was produced from HEK293T cells transfected with SCG5 cDNA clone (Cat# RC202772) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202772
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202772 representing NM_003020
  Red=Cloning site Green=Tags(s)
  
  MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVG
  PQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFS
  REFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDP
  E
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003011
• RefSeq Size: 1241
• RefSeq ORF: 633
• Synonyms: 7B2; P7B2; SGNE1; SgV
• Locus ID: 6447
• UniProt ID: P05408
• Cytogenetics: 15q13.3
• Summary: 'This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the trafficking and activation of prohormone convertase PC2 (encoded by Gene ID: 5126). Phosphorylation of the encoded protein has been shown to have an inhibitory effect on its chaperone function. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein. [provided by RefSeq, Feb 2019]'
• Protein Families: Secreted Protein