Secretogranin V (SCG5) (NM_003020) Human Recombinant Protein

CAT#: TP302772

Recombinant protein of human secretogranin V (7B2 protein) (SCG5), transcript variant 2

Product Images

Coomassie blue staining of purified SCG5 protein (Cat# TP302772). The protein was produced from HEK293T cells transfected with SCG5 cDNA clone (Cat# RC202772) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202772 representing NM_003020
  Red=Cloning site Green=Tags(s)
  
  MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVG
  PQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFS
  REFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDP
  E
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003011
• Locus ID: 6447
• UniProt ID: P05408
• Cytogenetics: 15q13.3
• Refseq Size: 1241
• Refseq ORF: 633
• Synonyms: 7B2; P7B2; SGNE1; SgV
• Summary: This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the trafficking and activation of prohormone convertase PC2 (encoded by Gene ID: 5126). Phosphorylation of the encoded protein has been shown to have an inhibitory effect on its chaperone function. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein. [provided by RefSeq, Feb 2019]
• Protein Families: Secreted Protein