REG1 alpha (REG1A) (NM_002909) Human Mass Spec Standard

CAT#: PH302773

REG1A MS Standard C13 and N15-labeled recombinant protein (NP_002900)

Product Images

Coomassie blue staining of purified REG1A protein (Cat# TP302773). The protein was produced from HEK293T cells transfected with REG1A cDNA clone (Cat# RC202773) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202773
• Predicted MW: 18.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202773 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSG
  NLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSL
  TSSTGFQKWKDVPCEDKFSFVCKFKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002900
• RefSeq Size: 821
• RefSeq ORF: 498
• Synonyms: ICRF; P19; PSP; PSPS; PSPS1; PTP; REG
• Locus ID: 5967
• UniProt ID: P05451, A8K7G6
• Cytogenetics: 2p12
• Summary: 'This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008]'