REG1 alpha (REG1A) (NM_002909) Human Recombinant Protein

CAT#: TP302773

Recombinant protein of human regenerating islet-derived 1 alpha (REG1A)

Product Images

Coomassie blue staining of purified REG1A protein (Cat# TP302773). The protein was produced from HEK293T cells transfected with REG1A cDNA clone (Cat# RC202773) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202773 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSG
  NLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSL
  TSSTGFQKWKDVPCEDKFSFVCKFKN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002900
• Locus ID: 5967
• UniProt ID: P05451, A8K7G6
• Cytogenetics: 2p12
• Refseq Size: 821
• Refseq ORF: 498
• Synonyms: ICRF; P19; PSP; PSPS; PSPS1; PTP; REG
• Summary: This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008]