ARHI (DIRAS3) (NM_004675) Human Mass Spec Standard

CAT#: PH302787

DIRAS3 MS Standard C13 and N15-labeled recombinant protein (NP_004666)

Product Images

Coomassie blue staining of purified DIRAS3 protein (Cat# TP302787). The protein was produced from HEK293T cells transfected with DIRAS3 cDNA clone (Cat# RC202787) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202787
• Predicted MW: 25.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202787 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
  ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
  NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
  KKSQMPNTTEKLLDKCIIM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004666
• RefSeq Size: 1642
• RefSeq ORF: 687
• Synonyms: ARHI; NOEY2
• Locus ID: 9077
• UniProt ID: O95661
• Cytogenetics: 1p31.3
• Summary: This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]