ARHI (DIRAS3) (NM_004675) Human Recombinant Protein

CAT#: TP302787

Recombinant protein of human DIRAS family, GTP-binding RAS-like 3 (DIRAS3)

Product Images

CDK5 enhanced phosphorylation of TP53 and p27Kip, as measured by a fluorescence-based in vitro kinase assay. The unrelated protein, ARHI-NTD (OriGene TP302787), served as a negative control, and histone H1 as a positive control. Figure cited from PLoS ONE, PMID: 26146988

• 

  Coomassie blue staining of purified DIRAS3 protein (Cat# TP302787). The protein was produced from HEK293T cells transfected with DIRAS3 cDNA clone (Cat# RC202787) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202787 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
  ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
  NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
  KKSQMPNTTEKLLDKCIIM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: In vitro kinase assay substrate (negative control) (PMID: 26146988)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004666
• Locus ID: 9077
• UniProt ID: O95661
• Cytogenetics: 1p31.3
• Refseq Size: 1642
• Refseq ORF: 687
• Synonyms: ARHI; NOEY2
• Summary: This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]