Geminin (GMNN) (NM_015895) Human Mass Spec Standard

CAT#: PH302808

GMNN MS Standard C13 and N15-labeled recombinant protein (NP_056979)

Product Images

Coomassie blue staining of purified GMNN protein (Cat# TP302808). The protein was produced from HEK293T cells transfected with GMNN cDNA clone (Cat# RC202808) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202808
• Predicted MW: 23.6 kDa
• Protein Sequence:
  Sequence Link

  >RC202808 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVP
  ESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKE
  LAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056979
• RefSeq Size: 1275
• RefSeq ORF: 627
• Synonyms: Gem; MGORS6
• Locus ID: 51053
• UniProt ID: O75496, A0A024QZY7
• Cytogenetics: 6p22.3
• Summary: This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome, Stem cell - Pluripotency