Geminin (GMNN) (NM_015895) Human Recombinant Protein
CAT#: TP302808
Recombinant protein of human geminin, DNA replication inhibitor (GMNN)
View other "GMNN" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202808 protein sequence
Red=Cloning site Green=Tags(s) MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVP ESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKE LAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056979 |
Locus ID | 51053 |
UniProt ID | O75496, A0A024QZY7 |
Cytogenetics | 6p22.3 |
Refseq Size | 1275 |
Refseq ORF | 627 |
Synonyms | Gem; MGORS6 |
Summary | This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402469 | GMNN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402469 | Transient overexpression lysate of geminin, DNA replication inhibitor (GMNN) |
USD 396.00 |
|
PH302808 | GMNN MS Standard C13 and N15-labeled recombinant protein (NP_056979) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review