RFK (NM_018339) Human Mass Spec Standard

CAT#: PH302812

RFK MS Standard C13 and N15-labeled recombinant protein (NP_060809)

Product Images

Coomassie blue staining of purified RFK protein (Cat# TP302812). The protein was produced from HEK293T cells transfected with RFK cDNA clone (Cat# RC202812) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202812
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202812 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRADCIMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVV
  SIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELP
  EHLKIKEDNFFQVSKSKIMNGH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060809
• RefSeq Size: 2707
• RefSeq ORF: 486
• Synonyms: RIFK
• Locus ID: 55312
• UniProt ID: Q969G6, B2RDZ2
• Cytogenetics: 9q21.13
• Summary: Riboflavin kinase (RFK; EC 2.7.1.26) is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesis (Karthikeyan et al., 2003 [PubMed 12623014]). [supplied by OMIM, Nov 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Riboflavin metabolism