RFK (NM_018339) Human Recombinant Protein

CAT#: TP302812

Recombinant protein of human riboflavin kinase (RFK)

Product Images

Coomassie blue staining of purified RFK protein (Cat# TP302812). The protein was produced from HEK293T cells transfected with RFK cDNA clone (Cat# RC202812) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202812 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRADCIMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVV
  SIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELP
  EHLKIKEDNFFQVSKSKIMNGH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060809
• Locus ID: 55312
• UniProt ID: Q969G6, B2RDZ2
• Cytogenetics: 9q21.13
• Refseq Size: 2707
• Refseq ORF: 486
• Synonyms: RIFK
• Summary: Riboflavin kinase (RFK; EC 2.7.1.26) is an essential enzyme that catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN), an obligatory step in vitamin B2 utilization and flavin cofactor synthesis (Karthikeyan et al., 2003 [PubMed 12623014]).[supplied by OMIM, Nov 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Riboflavin metabolism