PLCXD1 (NM_018390) Human Mass Spec Standard

CAT#: PH302835

PLCXD1 MS Standard C13 and N15-labeled recombinant protein (NP_060860)

Product Images

Coomassie blue staining of purified PLCXD1 protein (Cat# TP302835). The protein was produced from HEK293T cells transfected with PLCXD1 cDNA clone (Cat# RC202835) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202835
• Predicted MW: 36.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202835 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN
  KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW
  LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR
  HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL
  SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060860
• RefSeq Size: 5320
• RefSeq ORF: 969
• Synonyms: LL0XNC01-136G2.1
• Locus ID: 55344
• UniProt ID: Q9NUJ7
• Cytogenetics: Xp22.33 and Yp11.32-p11.31
• Summary: This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]