PLCXD1 (NM_018390) Human Recombinant Protein

CAT#: TP302835

Recombinant protein of human phosphatidylinositol-specific phospholipase C, X domain containing 1 (PLCXD1)

Product Images

Coomassie blue staining of purified PLCXD1 protein (Cat# TP302835). The protein was produced from HEK293T cells transfected with PLCXD1 cDNA clone (Cat# RC202835) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202835 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN
  KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW
  LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR
  HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL
  SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060860
• Locus ID: 55344
• UniProt ID: Q9NUJ7
• Cytogenetics: X;Y
• Refseq Size: 5320
• Refseq ORF: 969
• Synonyms: LL0XNC01-136G2.1
• Summary: This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]