PARP16 (NM_017851) Human Mass Spec Standard

CAT#: PH302846

PARP16 MS Standard C13 and N15-labeled recombinant protein (NP_060321)

Product Images

Coomassie blue staining of purified PARP16 protein (Cat# TP302846). The protein was produced from HEK293T cells transfected with PARP16 cDNA clone (Cat# RC202846) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202846
• Predicted MW: 36.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202846 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKE
  LLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYE
  TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS
  CVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRA
  SSQLSWFSSHWFTVMISLYLLLLLIVSVINSSAFQHFWNRAKR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060321
• RefSeq Size: 2551
• RefSeq ORF: 969
• Synonyms: ARTD15; C15orf30; pART15
• Locus ID: 54956
• UniProt ID: Q8N5Y8
• Cytogenetics: 15q22.31
• Summary: Intracellular mono-ADP-ribosyltransferase that may play a role in different processes through the mono-ADP-ribosylation of proteins involved in those processes (PubMed:23103912, PubMed:22701565). May play a role in the unfolded protein response (UPR), by ADP-ribosylating and activating EIF2AK3 and ERN1, two important UPR effectors (PubMed:23103912). May also mediate mono-ADP-ribosylation of karyopherin KPNB1 a nuclear import factor (PubMed:22701565). May not modify proteins on arginine, cysteine or glutamate residues compared to other mono-ADP-ribosyltransferases (PubMed:22701565). [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane