NENF (NM_013349) Human Mass Spec Standard

CAT#: PH302850

NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481)

Product Images

Coomassie blue staining of purified NENF protein (Cat# TP302850). The protein was produced from HEK293T cells transfected with NENF cDNA clone (Cat# RC202850) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202850
• Predicted MW: 18.86 kDa
• Protein Sequence:
  Sequence Link

  >RC202850 representing NM_013349
  Red=Cloning site Green=Tags(s)
  
  MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG
  VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV
  GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037481
• RefSeq Size: 944
• RefSeq ORF: 516
• Synonyms: CIR2; SCIRP10; SPUF
• Locus ID: 29937
• UniProt ID: Q9UMX5
• Cytogenetics: 1q32.3
• Summary: This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009]
• Protein Families: Druggable Genome, Secreted Protein