NENF (NM_013349) Human Recombinant Protein

CAT#: TP302850

Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1

Product Images

Coomassie blue staining of purified NENF protein (Cat# TP302850). The protein was produced from HEK293T cells transfected with NENF cDNA clone (Cat# RC202850) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202850 representing NM_013349
  Red=Cloning site Green=Tags(s)
  
  MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG
  VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV
  GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037481
• Locus ID: 29937
• UniProt ID: Q9UMX5
• Cytogenetics: 1q32.3
• Refseq Size: 944
• Refseq ORF: 516
• Synonyms: CIR2; SCIRP10; SPUF
• Summary: This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009]
• Protein Families: Druggable Genome, Secreted Protein