NENF (NM_013349) Human Recombinant Protein
CAT#: TP302850
Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202850 representing NM_013349
Red=Cloning site Green=Tags(s) MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKG VVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIV GYTARRILNEDGSPNLDFKPEDQPHFDIKDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037481 |
Locus ID | 29937 |
UniProt ID | Q9UMX5 |
Cytogenetics | 1q32.3 |
Refseq Size | 944 |
Refseq ORF | 516 |
Synonyms | CIR2; SCIRP10; SPUF |
Summary | This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415653 | NENF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415653 | Transient overexpression lysate of neuron derived neurotrophic factor (NENF), transcript variant 1 |
USD 325.00 |
|
PH302850 | NENF MS Standard C13 and N15-labeled recombinant protein (NP_037481) |
USD 2,055.00 |
|
TP701036 | Purified recombinant protein of Human neuron derived neurotrophic factor (NENF), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review