Cpn10 (HSPE1) (NM_002157) Human Mass Spec Standard

CAT#: PH302891

HSPE1 MS Standard C13 and N15-labeled recombinant protein (NP_002148)

Product Images

Coomassie blue staining of purified HSPE1 protein (Cat# TP302891). The protein was produced from HEK293T cells transfected with HSPE1 cDNA clone (Cat# RC202891) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202891
• Predicted MW: 10.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202891 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK
  VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002148
• RefSeq Size: 965
• RefSeq ORF: 306
• Synonyms: CPN10; EPF; GROES; HSP10
• Locus ID: 3336
• UniProt ID: P61604, A0A384N6A4
• Cytogenetics: 2q33.1
• Summary: 'This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency