Cpn10 (HSPE1) (NM_002157) Human Recombinant Protein
CAT#: TP302891
Recombinant protein of human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1)
View other "HSPE1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202891 protein sequence
Red=Cloning site Green=Tags(s) MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002148 |
Locus ID | 3336 |
UniProt ID | P61604, A0A384N6A4 |
Cytogenetics | 2q33.1 |
Refseq Size | 965 |
Refseq ORF | 306 |
Synonyms | CPN10; EPF; GROES; HSP10 |
Summary | This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419493 | HSPE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419493 | Transient overexpression lysate of heat shock 10kDa protein 1 (chaperonin 10) (HSPE1) |
USD 396.00 |
|
PH302891 | HSPE1 MS Standard C13 and N15-labeled recombinant protein (NP_002148) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review