STMN2 (NM_007029) Human Mass Spec Standard

CAT#: PH302914

STMN2 MS Standard C13 and N15-labeled recombinant protein (NP_008960)

Product Images

Coomassie blue staining of purified STMN2 protein (Cat# TP302914). The protein was produced from HEK293T cells transfected with STMN2 cDNA clone (Cat# RC202914) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202914
• Predicted MW: 20.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202914 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRT
  LASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKME
  QIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008960
• RefSeq Size: 2232
• RefSeq ORF: 537
• Synonyms: SCG10; SCGN10
• Locus ID: 11075
• UniProt ID: Q93045
• Cytogenetics: 8q21.13
• Summary: This gene encodes a member of the stathmin family of phosphoproteins. Stathmin proteins function in microtubule dynamics and signal transduction. The encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis. Reductions in the expression of this gene have been associated with Down's syndrome and Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Nov 2010]