STMN2 (NM_007029) Human Recombinant Protein

CAT#: TP302914

Recombinant protein of human stathmin-like 2 (STMN2)

Product Images

Coomassie blue staining of purified STMN2 protein (Cat# TP302914). The protein was produced from HEK293T cells transfected with STMN2 cDNA clone (Cat# RC202914) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202914 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRT
  LASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKME
  QIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008960
• Locus ID: 11075
• UniProt ID: Q93045
• Cytogenetics: 8q21.13
• Refseq Size: 2232
• Refseq ORF: 537
• Synonyms: SCG10; SCGN10
• Summary: This gene encodes a member of the stathmin family of phosphoproteins. Stathmin proteins function in microtubule dynamics and signal transduction. The encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis. Reductions in the expression of this gene have been associated with Down's syndrome and Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Nov 2010]