Pet1 (FEV) (NM_017521) Human Mass Spec Standard

CAT#: PH302917

FEV MS Standard C13 and N15-labeled recombinant protein (NP_059991)

Product Images

Coomassie blue staining of purified FEV protein (Cat# TP302917). The protein was produced from HEK293T cells transfected with FEV cDNA clone (Cat# RC202917) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202917
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202917 representing NM_017521
  Red=Cloning site Green=Tags(s)
  
  MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEG
  GHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPA
  HAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGPAATAAAATAA
  LYPSPSLQPPPGPFGAVAAASHLGGHYH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059991
• RefSeq Size: 1901
• RefSeq ORF: 714
• Synonyms: HSRNAFEV; PET-1
• Locus ID: 54738
• UniProt ID: Q99581
• Cytogenetics: 2q35
• Summary: This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repressor. This gene is exclusively expressed in neurons of the central serotonin (5-HT) system, a system implicated in the pathogeny of such psychiatric diseases as depression, anxiety, and eating disorders. In some types of Ewing tumors, this gene is fused to the Ewing sarcoma (EWS) gene following chromosome translocations. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors