Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Mass Spec Standard

CAT#: PH302924

NFE2 MS Standard C13 and N15-labeled recombinant protein (NP_006154)

Product Images

Coomassie blue staining of purified NFE2 protein (Cat# TP302924). The protein was produced from HEK293T cells transfected with NFE2 cDNA clone (Cat# RC202924) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202924
• Predicted MW: 41.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202924 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI
  HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE
  DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG
  PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA
  QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY
  ALQQAADGTIFLVPRGTKMEATD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006154
• RefSeq Size: 1697
• RefSeq ORF: 1119
• Synonyms: NF-E2; p45
• Locus ID: 4778
• UniProt ID: Q16621, A8K3E0
• Cytogenetics: 12q13.13
• Summary: ''
• Protein Families: Transcription Factors