CCDC115 (NM_032357) Human Mass Spec Standard

CAT#: PH302967

CCDC115 MS Standard C13 and N15-labeled recombinant protein (NP_115733)

Product Images

Coomassie blue staining of purified CCDC115 protein (Cat# TP302967). The protein was produced from HEK293T cells transfected with CCDC115 cDNA clone (Cat# RC202967) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202967
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202967 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH
  ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS
  FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115733
• RefSeq Size: 2000
• RefSeq ORF: 540
• Synonyms: ccp1; CDG2O
• Locus ID: 84317
• UniProt ID: Q96NT0, A1QKJ6
• Cytogenetics: 2q21.1
• Summary: The protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) vesicles in some human cells. The encoded protein shares some homology with the yeast V-ATPase assembly factor Vma22p, and the orthologous protein in mouse promotes cell proliferation and suppresses cell death. Defects in this gene are a cause of congenital disorder of glycosylation, type IIo in humans. [provided by RefSeq, Mar 2016]