CCDC115 (NM_032357) Human Mass Spec Standard
CAT#: PH302967
CCDC115 MS Standard C13 and N15-labeled recombinant protein (NP_115733)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202967 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC202967 protein sequence
Red=Cloning site Green=Tags(s) MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115733 |
RefSeq Size | 2000 |
RefSeq ORF | 540 |
Synonyms | ccp1; CDG2O |
Locus ID | 84317 |
UniProt ID | Q96NT0, A1QKJ6 |
Cytogenetics | 2q21.1 |
Summary | The protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) vesicles in some human cells. The encoded protein shares some homology with the yeast V-ATPase assembly factor Vma22p, and the orthologous protein in mouse promotes cell proliferation and suppresses cell death. Defects in this gene are a cause of congenital disorder of glycosylation, type IIo in humans. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410194 | CCDC115 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410194 | Transient overexpression lysate of coiled-coil domain containing 115 (CCDC115) |
USD 396.00 |
|
TP302967 | Recombinant protein of human coiled-coil domain containing 115 (CCDC115) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review