CCDC115 (NM_032357) Human Recombinant Protein
CAT#: TP302967
Recombinant protein of human coiled-coil domain containing 115 (CCDC115)
View other "CCDC115" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202967 protein sequence
Red=Cloning site Green=Tags(s) MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115733 |
Locus ID | 84317 |
UniProt ID | Q96NT0, A1QKJ6 |
Cytogenetics | 2q21.1 |
Refseq Size | 2000 |
Refseq ORF | 540 |
Synonyms | ccp1; CDG2O |
Summary | The protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) vesicles in some human cells. The encoded protein shares some homology with the yeast V-ATPase assembly factor Vma22p, and the orthologous protein in mouse promotes cell proliferation and suppresses cell death. Defects in this gene are a cause of congenital disorder of glycosylation, type IIo in humans. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410194 | CCDC115 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410194 | Transient overexpression lysate of coiled-coil domain containing 115 (CCDC115) |
USD 396.00 |
|
PH302967 | CCDC115 MS Standard C13 and N15-labeled recombinant protein (NP_115733) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review