MGC13096 (PDCD2L) (NM_032346) Human Mass Spec Standard

CAT#: PH302997

PDCD2L MS Standard C13 and N15-labeled recombinant protein (NP_115722)

Product Images

Coomassie blue staining of purified PDCD2L protein (Cat# TP302997). The protein was produced from HEK293T cells transfected with PDCD2L cDNA clone (Cat# RC202997) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202997
• Predicted MW: 39.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202997 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSP
  FHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSP
  QFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSL
  LRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPT
  SEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQE
  DPDELLFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115722
• RefSeq Size: 1174
• RefSeq ORF: 1074
• Synonyms: MGC13096
• Locus ID: 84306
• UniProt ID: Q9BRP1
• Cytogenetics: 19q13.11
• Summary: Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase. [UniProtKB/Swiss-Prot Function]