MGC13096 (PDCD2L) (NM_032346) Human Recombinant Protein

CAT#: TP302997

Recombinant protein of human programmed cell death 2-like (PDCD2L)

Product Images

Coomassie blue staining of purified PDCD2L protein (Cat# TP302997). The protein was produced from HEK293T cells transfected with PDCD2L cDNA clone (Cat# RC202997) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202997 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSP
  FHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSP
  QFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSL
  LRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPT
  SEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQE
  DPDELLFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115722
• Locus ID: 84306
• UniProt ID: Q9BRP1
• Cytogenetics: 19q13.11
• Refseq Size: 1174
• Refseq ORF: 1074
• Summary: Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.[UniProtKB/Swiss-Prot Function]