IRAK4 (NM_016123) Human Mass Spec Standard

CAT#: PH303041

IRAK4 MS Standard C13 and N15-labeled recombinant protein (NP_057207)

Product Images

Coomassie blue staining of purified IRAK4 protein (Cat# TP303041). The protein was produced from HEK293T cells transfected with IRAK4 cDNA clone (Cat# RC203041) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203041
• Predicted MW: 51.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203041 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL
  LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN
  LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV
  AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT
  PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG
  TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
  ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057207
• RefSeq Size: 4303
• RefSeq ORF: 1380
• Synonyms: IPD1; IRAK-4; NY-REN-64; REN64
• Locus ID: 51135
• UniProt ID: Q9NWZ3, Q69FE3, B2RAP9, B4E359
• Cytogenetics: 12q12
• Summary: This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway