fast skeletal Myosin (MYLPF) (NM_013292) Human Mass Spec Standard

CAT#: PH303081

MYLPF MS Standard C13 and N15-labeled recombinant protein (NP_037424)

Product Images

Coomassie blue staining of purified MYLPF protein (Cat# TP303081). The protein was produced from HEK293T cells transfected with MYLPF cDNA clone (Cat# RC203081) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203081
• Predicted MW: 19 kDa
• Protein Sequence:
  Sequence Link

  >RC203081 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAM
  MKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMW
  AAFPPDVGGNVDYKNICYVITHGDAKDQE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037424
• RefSeq Size: 683
• RefSeq ORF: 507
• Synonyms: HUMMLC2B; MLC2B; MRLC2; MYL11
• Locus ID: 29895
• UniProt ID: Q96A32, A0A024QZG6
• Cytogenetics: 16p11.2
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction