fast skeletal Myosin (MYLPF) (NM_013292) Human Recombinant Protein

CAT#: TP303081

Recombinant protein of human myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF)

Product Images

Coomassie blue staining of purified MYLPF protein (Cat# TP303081). The protein was produced from HEK293T cells transfected with MYLPF cDNA clone (Cat# RC203081) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203081 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAM
  MKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMW
  AAFPPDVGGNVDYKNICYVITHGDAKDQE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037424
• Locus ID: 29895
• UniProt ID: Q96A32, A0A024QZG6
• Cytogenetics: 16p11.2
• Refseq Size: 683
• Refseq ORF: 507
• Synonyms: HUMMLC2B; MLC2B; MRLC2; MYL11
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction