HRSP12 (RIDA) (NM_005836) Human Mass Spec Standard

CAT#: PH303107

HRSP12 MS Standard C13 and N15-labeled recombinant protein (NP_005827)

Product Images

Coomassie blue staining of purified RIDA protein (Cat# TP303107). The protein was produced from HEK293T cells transfected with RIDA cDNA clone (Cat# RC203107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203107
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG
  CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005827
• RefSeq Size: 1011
• RefSeq ORF: 411
• Synonyms: hp14.5; HRSP12; P14.5; PSP; UK114
• Locus ID: 10247
• UniProt ID: P52758, A0A024R9H2
• Cytogenetics: 8q22.2