HRSP12 (RIDA) (NM_005836) Human Recombinant Protein

CAT#: TP303107

Recombinant protein of human heat-responsive protein 12 (HRSP12)

Product Images

Coomassie blue staining of purified RIDA protein (Cat# TP303107). The protein was produced from HEK293T cells transfected with RIDA cDNA clone (Cat# RC203107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG
  CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005827
• Locus ID: 10247
• UniProt ID: P52758, A0A024R9H2
• Cytogenetics: 8q22.2
• Refseq Size: 1011
• Refseq ORF: 411
• Synonyms: hp14.5; HRSP12; P14.5; PSP; UK114
• Summary: Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase.[UniProtKB/Swiss-Prot Function]